SCOPe 2.06: Domain d1ahsb_: 1ahs B:

Lineage for d1ahsb_ (1ahs B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins)
   this domain is inserted into a multihelical domain

6. Protein RDV p8, central (top) domain [100924] (2 species)

7. Species African horse sickness virus [TaxId:40050] [49822] (1 PDB entry)

8. Domain d1ahsb_: 1ahs B: [23795]

Details for d1ahsb_

PDB Entry: 1ahs, 2.3 Å

PDB Description: crystal structure of the top domain of african horse sickness virus vp7

PDB Compounds: (B:) african horse sickness virus (serotype 4) vp7

SCOPe Domain Sequences for d1ahsb_:

Sequence; same for both SEQRES and ATOM records:

>d1ahsb_ b.19.1.1 (B:) RDV p8, central (top) domain {African horse sickness virus [TaxId: 40050]}
tgpyagavevqqsgryyvpqgrtrggyinsniaevcmdagaagqvnallaprrgdavmiy
fvwrplrifcdpqgaslesapgtfvtvdgvnvaagdvvawntiapvnvgnpgarrsilqf
evlwyt

Timeline for d1ahsb_:

• d1ahsb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ahsb_ appears in SCOPe 2.05
  
• d1ahsb_ appears in SCOPe 2.07
  
• d1ahsb_ appears in the current release, SCOPe 2.08