![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
![]() | Protein automated matches [191055] (20 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [230479] (5 PDB entries) |
![]() | Domain d4je6a1: 4je6 A:2-190 [237949] Other proteins in same PDB: d4je6a2, d4je6b2 automated match to d4je7a_ complexed with zn |
PDB Entry: 4je6 (more details), 2 Å
SCOPe Domain Sequences for d4je6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4je6a1 d.167.1.0 (A:2-190) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} dlpeivasgdpvlhekarevdpgeigseriqkiiddmikvmrlapcvglaapqigvplri ivledtkeyisyapkeeilaqerrhfdlmvmvnpvlkersnkkalffegcesvdgfraav erylevvvtgydrqgkrievnasgwqarilqhecdhldgnlyvdkmvprtfrtvdnldlp laegcpklg
Timeline for d4je6a1: