SCOPe 2.03: Domain d4je6a_: 4je6 A:

Lineage for d4je6a_ (4je6 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (9 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [230479] (4 PDB entries)

8. Domain d4je6a_: 4je6 A: [237949]
   automated match to d4je7a_
   complexed with zn

Details for d4je6a_

PDB Entry: 4je6, 2 Å

PDB Description: Crystal structure of a human-like mitochondrial peptide deformylase

PDB Compounds: (A:) Peptide deformylase 1A, chloroplastic/mitochondrial

SCOPe Domain Sequences for d4je6a_:

Sequence; same for both SEQRES and ATOM records:

>d4je6a_ d.167.1.0 (A:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
dlpeivasgdpvlhekarevdpgeigseriqkiiddmikvmrlapcvglaapqigvplri
ivledtkeyisyapkeeilaqerrhfdlmvmvnpvlkersnkkalffegcesvdgfraav
erylevvvtgydrqgkrievnasgwqarilqhecdhldgnlyvdkmvprtfrtvdnldlp
laegcpklgshhh

Timeline for d4je6a_:

• d4je6a_ is new in SCOPe 2.03-stable
  
• d4je6a_ appears in SCOPe 2.04
  
• d4je6a_ appears in the current release, SCOPe 2.08, called d4je6a1