Lineage for d4ij4a_ (4ij4 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152584Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2152585Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2154522Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 2154523Protein automated matches [190563] (13 species)
    not a true protein
  7. 2154524Species Bryum coronatum [TaxId:216087] [237943] (2 PDB entries)
  8. 2154526Domain d4ij4a_: 4ij4 A: [237944]
    automated match to d1dxja_
    complexed with edo

Details for d4ij4a_

PDB Entry: 4ij4 (more details), 1.58 Å

PDB Description: Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4
PDB Compounds: (A:) chitinase a

SCOPe Domain Sequences for d4ij4a_:

Sequence, based on SEQRES records: (download)

>d4ij4a_ d.2.1.0 (A:) automated matches {Bryum coronatum [TaxId: 216087]}
swtsfvtpavfegwfpnrnpfytydglvsasngypefgttgslddqkrelaaflgninqa
sgglqfiqeqnpqsdycdtsstqypcaagkqyygrgpiqlswnynygeagadlgldllnn
pdlvaqdstvawrtalwfwmkrdchgaitasppsfsgtiriingglecnqpagsignmqm
enrvtyytqfcqtlgvdpgtdlrc

Sequence, based on observed residues (ATOM records): (download)

>d4ij4a_ d.2.1.0 (A:) automated matches {Bryum coronatum [TaxId: 216087]}
swtsfvtpavfegwfpnrnpfytydglvsasngypefgttgslddqkrelaaflgninqa
sgglqfiqeqnpsdycdtsstqypcaagkqyygrgpiqlswnynygeagadlgldllnnp
dlvaqdstvawrtalwfwmkrdchgaitasppsfsgtiriingglecnqpagsignmqme
nrvtyytqfcqtlgvdpgtdlrc

SCOPe Domain Coordinates for d4ij4a_:

Click to download the PDB-style file with coordinates for d4ij4a_.
(The format of our PDB-style files is described here.)

Timeline for d4ij4a_: