Lineage for d1ahsa_ (1ahs A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385150Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins)
    this domain is inserted into a multihelical domain
  6. 2385172Protein RDV p8, central (top) domain [100924] (2 species)
  7. 2385173Species African horse sickness virus [TaxId:40050] [49822] (1 PDB entry)
  8. 2385174Domain d1ahsa_: 1ahs A: [23794]

Details for d1ahsa_

PDB Entry: 1ahs (more details), 2.3 Å

PDB Description: crystal structure of the top domain of african horse sickness virus vp7
PDB Compounds: (A:) african horse sickness virus (serotype 4) vp7

SCOPe Domain Sequences for d1ahsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahsa_ b.19.1.1 (A:) RDV p8, central (top) domain {African horse sickness virus [TaxId: 40050]}
tgpyagavevqqsgryyvpqgrtrggyinsniaevcmdagaagqvnallaprrgdavmiy
fvwrplrifcdpqgaslesapgtfvtvdgvnvaagdvvawntiapvnvgnpgarrsilqf
evlwyt

SCOPe Domain Coordinates for d1ahsa_:

Click to download the PDB-style file with coordinates for d1ahsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ahsa_: