Lineage for d1ahsa_ (1ahs A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57292Fold b.19: Viral protein domain [49817] (1 superfamily)
  4. 57293Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
  5. 57294Family b.19.1.1: Top domain of virus capsid protein [49819] (2 proteins)
  6. 57295Protein Virus capsid protein vp7 (BTV-10 vp7), central (top) domain [49820] (2 species)
  7. 57296Species African horse sickness virus [TaxId:40050] [49822] (1 PDB entry)
  8. 57297Domain d1ahsa_: 1ahs A: [23794]

Details for d1ahsa_

PDB Entry: 1ahs (more details), 2.3 Å

PDB Description: crystal structure of the top domain of african horse sickness virus vp7

SCOP Domain Sequences for d1ahsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahsa_ b.19.1.1 (A:) Virus capsid protein vp7 (BTV-10 vp7), central (top) domain {African horse sickness virus}
tgpyagavevqqsgryyvpqgrtrggyinsniaevcmdagaagqvnallaprrgdavmiy
fvwrplrifcdpqgaslesapgtfvtvdgvnvaagdvvawntiapvnvgnpgarrsilqf
evlwyt

SCOP Domain Coordinates for d1ahsa_:

Click to download the PDB-style file with coordinates for d1ahsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ahsa_: