| Class b: All beta proteins [48724] (104 folds) |
| Fold b.19: Viral protein domain [49817] (1 superfamily) |
Superfamily b.19.1: Viral protein domain [49818] (3 families) ![]() |
| Family b.19.1.1: Top domain of virus capsid protein [49819] (2 proteins) |
| Protein Virus capsid protein vp7 (BTV-10 vp7), central (top) domain [49820] (2 species) |
| Species African horse sickness virus [TaxId:40050] [49822] (1 PDB entry) |
| Domain d1ahsa_: 1ahs A: [23794] |
PDB Entry: 1ahs (more details), 2.3 Å
SCOP Domain Sequences for d1ahsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahsa_ b.19.1.1 (A:) Virus capsid protein vp7 (BTV-10 vp7), central (top) domain {African horse sickness virus}
tgpyagavevqqsgryyvpqgrtrggyinsniaevcmdagaagqvnallaprrgdavmiy
fvwrplrifcdpqgaslesapgtfvtvdgvnvaagdvvawntiapvnvgnpgarrsilqf
evlwyt
Timeline for d1ahsa_: