Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) |
Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins) binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins automatically mapped to Pfam PF01880 |
Protein automated matches [190694] (2 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [237934] (2 PDB entries) |
Domain d4bfkc_: 4bfk C: [237938] automated match to d1dqia_ complexed with fe; mutant |
PDB Entry: 4bfk (more details), 2.1 Å
SCOPe Domain Sequences for d4bfkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bfkc_ b.1.13.1 (C:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} melfqtadwkkqkhvpvievlraeggvvevkvsvgkeiphpnttehhiawielvfqpegs kfpyvvgraefaahgasvdgpntsgvytdpvavfafkaeksgkltafsycnihglwmgea tlsle
Timeline for d4bfkc_: