SCOPe 2.03: Domain d4bfkc_: 4bfk C:

Lineage for d4bfkc_ (4bfk C:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.13: Superoxide reductase-like [49367] (2 families)

5. Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
   binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
   automatically mapped to Pfam PF01880

6. Protein automated matches [190694] (2 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [237934] (2 PDB entries)

8. Domain d4bfkc_: 4bfk C: [237938]
   automated match to d1dqia_
   complexed with fe; mutant

Details for d4bfkc_

PDB Entry: 4bfk, 2.1 Å

PDB Description: Superoxide reductase (Neelaredoxin) from Archaeoglobus fulgidus E12Q mutant

PDB Compounds: (C:) superoxide reductase

SCOPe Domain Sequences for d4bfkc_:

Sequence; same for both SEQRES and ATOM records:

>d4bfkc_ b.1.13.1 (C:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
melfqtadwkkqkhvpvievlraeggvvevkvsvgkeiphpnttehhiawielvfqpegs
kfpyvvgraefaahgasvdgpntsgvytdpvavfafkaeksgkltafsycnihglwmgea
tlsle

Timeline for d4bfkc_:

• d4bfkc_ is new in SCOPe 2.03-stable
  
• d4bfkc_ appears in SCOPe 2.04
  
• d4bfkc_ appears in the current release, SCOPe 2.08