Lineage for d4bfka_ (4bfk A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764803Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 2764804Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
    binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
    automatically mapped to Pfam PF01880
  6. 2764827Protein automated matches [190694] (3 species)
    not a true protein
  7. 2764828Species Archaeoglobus fulgidus [TaxId:2234] [237934] (4 PDB entries)
  8. 2764829Domain d4bfka_: 4bfk A: [237936]
    automated match to d1dqia_
    complexed with fe; mutant

Details for d4bfka_

PDB Entry: 4bfk (more details), 2.1 Å

PDB Description: Superoxide reductase (Neelaredoxin) from Archaeoglobus fulgidus E12Q mutant
PDB Compounds: (A:) superoxide reductase

SCOPe Domain Sequences for d4bfka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bfka_ b.1.13.1 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
elfqtadwkkqkhvpvievlraeggvvevkvsvgkeiphpnttehhiawielvfqpegsk
fpyvvgraefaahgasvdgpntsgvytdpvavfafkaeksgkltafsycnihglwmgeat
lsle

SCOPe Domain Coordinates for d4bfka_:

Click to download the PDB-style file with coordinates for d4bfka_.
(The format of our PDB-style files is described here.)

Timeline for d4bfka_: