Lineage for d4bffl_ (4bff L:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1769954Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 1770022Family b.1.13.0: automated matches [191383] (1 protein)
    not a true family
  6. 1770023Protein automated matches [190481] (2 species)
    not a true protein
  7. 1770024Species Archaeoglobus fulgidus [TaxId:2234] [237922] (2 PDB entries)
  8. 1770040Domain d4bffl_: 4bff L: [237933]
    automated match to d2hvba_
    complexed with fe2

Details for d4bffl_

PDB Entry: 4bff (more details), 2 Å

PDB Description: Superoxide reductase (Neelaredoxin) from Archaeoglobus fulgidus in the reduced form
PDB Compounds: (L:) superoxide reductase

SCOPe Domain Sequences for d4bffl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bffl_ b.1.13.0 (L:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
elfqtadwkkekhvpvievlraeggvvevkvsvgkeiphpnttehhiawielvfqpegsk
fpyvvgraefaahgasvdgpntsgvytdpvavfafkaeksgkltafsycnihglwmgeat
lsl

SCOPe Domain Coordinates for d4bffl_:

Click to download the PDB-style file with coordinates for d4bffl_.
(The format of our PDB-style files is described here.)

Timeline for d4bffl_: