Lineage for d4bffj_ (4bff J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764803Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 2764871Family b.1.13.0: automated matches [191383] (1 protein)
    not a true family
  6. 2764872Protein automated matches [190481] (2 species)
    not a true protein
  7. 2764873Species Archaeoglobus fulgidus [TaxId:2234] [237922] (2 PDB entries)
  8. 2764883Domain d4bffj_: 4bff J: [237932]
    automated match to d2hvba_
    complexed with fe2

Details for d4bffj_

PDB Entry: 4bff (more details), 2 Å

PDB Description: Superoxide reductase (Neelaredoxin) from Archaeoglobus fulgidus in the reduced form
PDB Compounds: (J:) superoxide reductase

SCOPe Domain Sequences for d4bffj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bffj_ b.1.13.0 (J:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
elfqtadwkkekhvpvievlraeggvvevkvsvgkeiphpnttehhiawielvfqpegsk
fpyvvgraefaahgasvdgpntsgvytdpvavfafkaeksgkltafsycnihglwmgeat
lsl

SCOPe Domain Coordinates for d4bffj_:

Click to download the PDB-style file with coordinates for d4bffj_.
(The format of our PDB-style files is described here.)

Timeline for d4bffj_: