Lineage for d4bffe_ (4bff E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038341Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 2038409Family b.1.13.0: automated matches [191383] (1 protein)
    not a true family
  6. 2038410Protein automated matches [190481] (2 species)
    not a true protein
  7. 2038411Species Archaeoglobus fulgidus [TaxId:2234] [237922] (2 PDB entries)
  8. 2038416Domain d4bffe_: 4bff E: [237928]
    automated match to d2hvba_
    complexed with fe2

Details for d4bffe_

PDB Entry: 4bff (more details), 2 Å

PDB Description: Superoxide reductase (Neelaredoxin) from Archaeoglobus fulgidus in the reduced form
PDB Compounds: (E:) superoxide reductase

SCOPe Domain Sequences for d4bffe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bffe_ b.1.13.0 (E:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
elfqtadwkkekhvpvievlraeggvvevkvsvgkeiphpnttehhiawielvfqpegsk
fpyvvgraefaahgasvdgpntsgvytdpvavfafkaeksgkltafsycnihglwmgeat
lsl

SCOPe Domain Coordinates for d4bffe_:

Click to download the PDB-style file with coordinates for d4bffe_.
(The format of our PDB-style files is described here.)

Timeline for d4bffe_: