SCOPe 2.05: Domain d3zq3b_: 3zq3 B:

Lineage for d3zq3b_ (3zq3 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (13 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [237753] (2 PDB entries)

8. Domain d3zq3b_: 3zq3 B: [237921]
   automated match to d3zq3a_

Details for d3zq3b_

PDB Entry: 3zq3, 2.8 Å

PDB Description: Crystal Structure of Rat Odorant Binding Protein 3 (OBP3)

PDB Compounds: (B:) obp3 protein

SCOPe Domain Sequences for d3zq3b_:

Sequence; same for both SEQRES and ATOM records:

>d3zq3b_ b.60.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eeasfergnldvdklngdwfsivvasdkrekieengsmrvfvqhidvlenslgftfrike
ngvctefslvadktakdgeyfveydgentftilktdydnyvmfhlvnvnngetfqlmely
grtkdlssdikekfaklcvahgitrdniidltktdrclq

Timeline for d3zq3b_:

• d3zq3b_ first appeared in SCOPe 2.03
  
• d3zq3b_ appears in SCOPe 2.04
  
• d3zq3b_ appears in SCOPe 2.06
  
• d3zq3b_ appears in the current release, SCOPe 2.08