| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Neocallimastix patriciarum [TaxId:4758] [237916] (5 PDB entries) |
| Domain d3wp5a_: 3wp5 A: [237917] automated match to d1igoa_ mutant |
PDB Entry: 3wp5 (more details), 1.32 Å
SCOPe Domain Sequences for d3wp5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wp5a_ b.29.1.0 (A:) automated matches {Neocallimastix patriciarum [TaxId: 4758]}
efqsfcssashsgqsvkvtgnkvgtiggvgyelwadsgnnsatfysdgsfsctfqnagdy
lcrsglsfdstktpsqigrmkadfklvkqnssnvgysyvgvygwtrsplvayyivdnwls
pfppgdwvgnkkhgsftidgaqytvyentrtgpsidgdttfnqyfsirqqardcgtidis
ahfdqweklgmtmgklheakvlgeagnvnggasgtadfpyakvyigd
Timeline for d3wp5a_: