Lineage for d3wp5a_ (3wp5 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781214Species Neocallimastix patriciarum [TaxId:4758] [237916] (5 PDB entries)
  8. 2781217Domain d3wp5a_: 3wp5 A: [237917]
    automated match to d1igoa_
    mutant

Details for d3wp5a_

PDB Entry: 3wp5 (more details), 1.32 Å

PDB Description: the crystal structure of mutant cdbfv e109a from neocallimastix patriciarum
PDB Compounds: (A:) cdbfv

SCOPe Domain Sequences for d3wp5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wp5a_ b.29.1.0 (A:) automated matches {Neocallimastix patriciarum [TaxId: 4758]}
efqsfcssashsgqsvkvtgnkvgtiggvgyelwadsgnnsatfysdgsfsctfqnagdy
lcrsglsfdstktpsqigrmkadfklvkqnssnvgysyvgvygwtrsplvayyivdnwls
pfppgdwvgnkkhgsftidgaqytvyentrtgpsidgdttfnqyfsirqqardcgtidis
ahfdqweklgmtmgklheakvlgeagnvnggasgtadfpyakvyigd

SCOPe Domain Coordinates for d3wp5a_:

Click to download the PDB-style file with coordinates for d3wp5a_.
(The format of our PDB-style files is described here.)

Timeline for d3wp5a_: