SCOPe 2.08: Domain d4oawc2: 4oaw C:108-214

Lineage for d4oawc2 (4oaw C:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4oawc2: 4oaw C:108-214 [237882]
   Other proteins in same PDB: d4oawa1, d4oawb_, d4oawc1, d4oawd_
   automated match to d1n0xl2
   complexed with gol, so4

Details for d4oawc2

PDB Entry: 4oaw, 2.8 Å

PDB Description: fab structure of anti-hiv gp120 v2 mab 2158

PDB Compounds: (C:) Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158

SCOPe Domain Sequences for d4oawc2:

Sequence; same for both SEQRES and ATOM records:

>d4oawc2 b.1.1.2 (C:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhklyacevthqglsspvtksfnrgec

Timeline for d4oawc2:

• d4oawc2 first appeared in SCOPe 2.03
  
• d4oawc2 appears in SCOPe 2.07