| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
| Protein automated matches [190406] (19 species) not a true protein |
| Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (24 PDB entries) |
| Domain d4oj0a1: 4oj0 A:3-228 [237878] Other proteins in same PDB: d4oj0a2, d4oj0b1, d4oj0b2, d4oj0c1, d4oj0c2, d4oj0d1, d4oj0d2 automated match to d3e5va_ |
PDB Entry: 4oj0 (more details), 1.7 Å
SCOPe Domain Sequences for d4oj0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oj0a1 d.22.1.1 (A:3-228) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
elikenmpmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfafdilatcf
mygsktfikhpkgipdffkqsfpegftwervttyedggvltvtqdtslqdgcliynvklr
gvnfpsngpvmqkktlgweattetlypadgglegrcdmalkldggghlhcnlkttyrskk
pagnlkmpgvyfvdrrlerikeadnetyveqhevaearycdlpskl
Timeline for d4oj0a1: