SCOPe 2.03: Domain d4ocmf_: 4ocm F:

Lineage for d4ocmf_ (4ocm F:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (60 PDB entries)

8. Domain d4ocmf_: 4ocm F: [237873]
   automated match to d4ocnc_
   complexed with k, zn

Details for d4ocmf_

PDB Entry: 4ocm, 1.99 Å

PDB Description: crystal structure of the rpn8-rpn11 mpn domain heterodimer, crystal form ib

PDB Compounds: (F:) Nb1

SCOPe Domain Sequences for d4ocmf_:

Sequence; same for both SEQRES and ATOM records:

>d4ocmf_ b.1.1.1 (F:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvpaggslrlscvdsgrtfsstvmawfrqapgkerefvatirwsggntyya
dsvkgrftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvs
shhhh

Timeline for d4ocmf_:

• d4ocmf_ is new in SCOPe 2.03-stable
  
• d4ocmf_ appears in SCOPe 2.04
  
• d4ocmf_ appears in the current release, SCOPe 2.08, called d4ocmf1