Lineage for d4ocmc_ (4ocm C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (19 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (141 PDB entries)
  8. 2347784Domain d4ocmc_: 4ocm C: [237872]
    Other proteins in same PDB: d4ocma_, d4ocmb_, d4ocmd_, d4ocme_
    automated match to d4ocnc_
    complexed with k, zn

Details for d4ocmc_

PDB Entry: 4ocm (more details), 1.99 Å

PDB Description: crystal structure of the rpn8-rpn11 mpn domain heterodimer, crystal form ib
PDB Compounds: (C:) Nb1

SCOPe Domain Sequences for d4ocmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ocmc_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvpaggslrlscvdsgrtfsstvmawfrqapgkerefvatirwsggntyya
dsvkgrftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvs
shhhh

SCOPe Domain Coordinates for d4ocmc_:

Click to download the PDB-style file with coordinates for d4ocmc_.
(The format of our PDB-style files is described here.)

Timeline for d4ocmc_: