Lineage for d4oclf_ (4ocl F:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (155 PDB entries)
  8. 2347816Domain d4oclf_: 4ocl F: [237871]
    Other proteins in same PDB: d4ocla_, d4oclb_, d4ocld_, d4ocle_
    automated match to d4ocnc_
    complexed with zn

Details for d4oclf_

PDB Entry: 4ocl (more details), 2.4 Å

PDB Description: Crystal Structure of the Rpn8-Rpn11 MPN domain heterodimer, crystal form Ia
PDB Compounds: (F:) Nb1

SCOPe Domain Sequences for d4oclf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oclf_ b.1.1.1 (F:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvpaggslrlscvdsgrtfsstvmawfrqapgkerefvatirwsggntyya
dsvkgrftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvs
shhhh

SCOPe Domain Coordinates for d4oclf_:

Click to download the PDB-style file with coordinates for d4oclf_.
(The format of our PDB-style files is described here.)

Timeline for d4oclf_: