Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
Domain d4oclc1: 4ocl C:7-122 [237870] Other proteins in same PDB: d4ocla_, d4oclb_, d4oclc2, d4oclc3, d4ocld_, d4ocle_, d4oclf2, d4oclf3 automated match to d4ocnc_ complexed with zn |
PDB Entry: 4ocl (more details), 2.4 Å
SCOPe Domain Sequences for d4oclc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oclc1 b.1.1.1 (C:7-122) automated matches {Llama (Lama glama) [TaxId: 9844]} esggglvpaggslrlscvdsgrtfsstvmawfrqapgkerefvatirwsggntyyadsvk grftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvs
Timeline for d4oclc1: