Lineage for d4oclc1 (4ocl C:7-122)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743952Domain d4oclc1: 4ocl C:7-122 [237870]
    Other proteins in same PDB: d4ocla_, d4oclb_, d4oclc2, d4oclc3, d4ocld_, d4ocle_, d4oclf2, d4oclf3
    automated match to d4ocnc_
    complexed with zn

Details for d4oclc1

PDB Entry: 4ocl (more details), 2.4 Å

PDB Description: Crystal Structure of the Rpn8-Rpn11 MPN domain heterodimer, crystal form Ia
PDB Compounds: (C:) Nb1

SCOPe Domain Sequences for d4oclc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oclc1 b.1.1.1 (C:7-122) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvpaggslrlscvdsgrtfsstvmawfrqapgkerefvatirwsggntyyadsvk
grftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvs

SCOPe Domain Coordinates for d4oclc1:

Click to download the PDB-style file with coordinates for d4oclc1.
(The format of our PDB-style files is described here.)

Timeline for d4oclc1: