Lineage for d4obab_ (4oba B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735235Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1735236Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1735237Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 1735244Protein MDM2 [47594] (2 species)
  7. 1735262Species Human (Homo sapiens) [TaxId:9606] [47596] (46 PDB entries)
  8. 1735303Domain d4obab_: 4oba B: [237867]
    automated match to d1t4ea_
    complexed with 2tw

Details for d4obab_

PDB Entry: 4oba (more details), 1.6 Å

PDB Description: Co-crystal structure of MDM2 with Inhibitor Compound 4
PDB Compounds: (B:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4obab_:

Sequence, based on SEQRES records: (download)

>d4obab_ a.42.1.1 (B:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
ipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycs
ndllgdlfgvpsfsvkehrkiytmiyrnlvvv

Sequence, based on observed residues (ATOM records): (download)

>d4obab_ a.42.1.1 (B:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
ipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydhivycsndll
gdlfgvpsfsvkehrkiytmiyrnlvvv

SCOPe Domain Coordinates for d4obab_:

Click to download the PDB-style file with coordinates for d4obab_.
(The format of our PDB-style files is described here.)

Timeline for d4obab_: