SCOPe 2.05: Domain d4obab_: 4oba B:

Lineage for d4obab_ (4oba B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (46 PDB entries)

8. Domain d4obab_: 4oba B: [237867]
   automated match to d1t4ea_
   complexed with 2tw

Details for d4obab_

PDB Entry: 4oba, 1.6 Å

PDB Description: Co-crystal structure of MDM2 with Inhibitor Compound 4

PDB Compounds: (B:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4obab_:

Sequence, based on SEQRES records:

>d4obab_ a.42.1.1 (B:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
ipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycs
ndllgdlfgvpsfsvkehrkiytmiyrnlvvv

Sequence, based on observed residues (ATOM records):

>d4obab_ a.42.1.1 (B:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
ipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydhivycsndll
gdlfgvpsfsvkehrkiytmiyrnlvvv

Timeline for d4obab_:

• d4obab_ first appeared in SCOPe 2.03
  
• d4obab_ appears in SCOPe 2.04
  
• d4obab_ appears in SCOPe 2.06
  
• d4obab_ appears in the current release, SCOPe 2.08