Lineage for d4o1ra_ (4o1r A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810029Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. 1810030Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (3 families) (S)
    duplication: contains two intertwined structural repeats
  5. 1810035Family b.86.1.2: Intein (protein splicing domain) [51298] (5 protein domains)
  6. 1810059Protein automated matches [237863] (2 species)
    not a true protein
  7. 1810062Species Nostoc punctiforme [TaxId:63737] [237864] (1 PDB entry)
  8. 1810063Domain d4o1ra_: 4o1r A: [237865]
    automated match to d1mi8a_
    complexed with cl, gol, na

Details for d4o1ra_

PDB Entry: 4o1r (more details), 1.4 Å

PDB Description: crystal structure of npudnab intein
PDB Compounds: (A:) Replicative DNA helicase

SCOPe Domain Sequences for d4o1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o1ra_ b.86.1.2 (A:) automated matches {Nostoc punctiforme [TaxId: 63737]}
sggalagdslvtlvdsglqvpikelvgksgfavwalneatmqlekaivsnafstgikplf
tlttrlgrkiratgnhkfltingwkrldeltpkehlalprnsgsdiywdeivsitysgee
evfdltvpglhnfvanniivhn

SCOPe Domain Coordinates for d4o1ra_:

Click to download the PDB-style file with coordinates for d4o1ra_.
(The format of our PDB-style files is described here.)

Timeline for d4o1ra_: