SCOPe 2.05: Domain d4o1ra_: 4o1r A:

Lineage for d4o1ra_ (4o1r A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
   complex fold made of five beta-hairpin units and a b-ribbon arc

4. Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (3 families)
   duplication: contains two intertwined structural repeats

5. Family b.86.1.2: Intein (protein splicing domain) [51298] (5 proteins)

6. Protein automated matches [237863] (2 species)
   not a true protein

7. Species Nostoc punctiforme [TaxId:63737] [237864] (1 PDB entry)

8. Domain d4o1ra_: 4o1r A: [237865]
   automated match to d1mi8a_
   complexed with cl, gol, na

Details for d4o1ra_

PDB Entry: 4o1r, 1.4 Å

PDB Description: crystal structure of npudnab intein

PDB Compounds: (A:) Replicative DNA helicase

SCOPe Domain Sequences for d4o1ra_:

Sequence; same for both SEQRES and ATOM records:

>d4o1ra_ b.86.1.2 (A:) automated matches {Nostoc punctiforme [TaxId: 63737]}
sggalagdslvtlvdsglqvpikelvgksgfavwalneatmqlekaivsnafstgikplf
tlttrlgrkiratgnhkfltingwkrldeltpkehlalprnsgsdiywdeivsitysgee
evfdltvpglhnfvanniivhn

Timeline for d4o1ra_:

• d4o1ra_ first appeared in SCOPe 2.03
  
• d4o1ra_ appears in SCOPe 2.04
  
• d4o1ra_ is called d4o1ra1 in SCOPe 2.06
  
• d4o1ra_ appears in the current release, SCOPe 2.08, called d4o1ra1