Lineage for d4nxja_ (4nxj A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731437Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1731536Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1731537Protein automated matches [190615] (7 species)
    not a true protein
  7. 1731925Species Plasmodium falciparum [TaxId:36329] [237857] (2 PDB entries)
  8. 1731930Domain d4nxja_: 4nxj A: [237859]
    automated match to d3p1fa_

Details for d4nxja_

PDB Entry: 4nxj (more details), 2.18 Å

PDB Description: crystal structure of pf3d7_1475600, a bromodomain from plasmodium falciparum
PDB Compounds: (A:) Bromodomain protein

SCOPe Domain Sequences for d4nxja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nxja_ a.29.2.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
gydeieelksknevltnllnkliafdkkriflypvnvqlvpdylnvikepmdfttmkqkl
qnfkyksfqefekdvlliinncytyndpstiyykfaedietyykklnikiqtkymnih

SCOPe Domain Coordinates for d4nxja_:

Click to download the PDB-style file with coordinates for d4nxja_.
(The format of our PDB-style files is described here.)

Timeline for d4nxja_: