| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
| Protein automated matches [190615] (15 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [237857] (4 PDB entries) |
| Domain d4nxja1: 4nxj A:2-118 [237859] Other proteins in same PDB: d4nxja2, d4nxjb2, d4nxjc2 automated match to d3p1fa_ |
PDB Entry: 4nxj (more details), 2.18 Å
SCOPe Domain Sequences for d4nxja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nxja1 a.29.2.0 (A:2-118) automated matches {Plasmodium falciparum [TaxId: 36329]}
ydeieelksknevltnllnkliafdkkriflypvnvqlvpdylnvikepmdfttmkqklq
nfkyksfqefekdvlliinncytyndpstiyykfaedietyykklnikiqtkymnih
Timeline for d4nxja1:
View in 3DDomains from other chains: (mouse over for more information) d4nxjb1, d4nxjb2, d4nxjc1, d4nxjc2 |