SCOPe 2.06: Domain d4nxjb1: 4nxj B:2-117

Lineage for d4nxjb1 (4nxj B:2-117)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (10 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [237857] (3 PDB entries)

8. Domain d4nxjb1: 4nxj B:2-117 [237858]
   Other proteins in same PDB: d4nxja2, d4nxjb2, d4nxjc2
   automated match to d3p1fa_

Details for d4nxjb1

PDB Entry: 4nxj, 2.18 Å

PDB Description: crystal structure of pf3d7_1475600, a bromodomain from plasmodium falciparum

PDB Compounds: (B:) Bromodomain protein

SCOPe Domain Sequences for d4nxjb1:

Sequence; same for both SEQRES and ATOM records:

>d4nxjb1 a.29.2.0 (B:2-117) automated matches {Plasmodium falciparum [TaxId: 36329]}
ydeieelksknevltnllnkliafdkkriflypvnvqlvpdylnvikepmdfttmkqklq
nfkyksfqefekdvlliinncytyndpstiyykfaedietyykklnikiqtkymni

Timeline for d4nxjb1:

• d4nxjb1 first appeared in SCOPe 2.03, called d4nxjb_
  
• d4nxjb1 was called d4nxjb_ in SCOPe 2.05
  
• d4nxjb1 appears in SCOPe 2.07
  
• d4nxjb1 appears in the current release, SCOPe 2.08