Lineage for d4niyc_ (4niy C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2796823Protein automated matches [190044] (14 species)
    not a true protein
  7. 2796835Species Cow (Bos taurus) [TaxId:9913] [187001] (23 PDB entries)
  8. 2796860Domain d4niyc_: 4niy C: [237853]
    Other proteins in same PDB: d4niye_, d4niyf_, d4niyg_, d4niyh_
    automated match to d4niwa_
    complexed with ca, zn

Details for d4niyc_

PDB Entry: 4niy (more details), 2.84 Å

PDB Description: Crystal structure of trypsiligase (K60E/N143H/Y151H/D189K trypsin) complexed to YRH-ecotin (M84Y/M85R/A86H ecotin)
PDB Compounds: (C:) cationic trypsin

SCOPe Domain Sequences for d4niyc_:

Sequence, based on SEQRES records: (download)

>d4niyc_ b.47.1.2 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyesgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wghtkssgtshpdvlkclkapilsdsscksaypgqitsnmfcagyleggkkscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Sequence, based on observed residues (ATOM records): (download)

>d4niyc_ b.47.1.2 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyesgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wghtdvlkclkapilsdsscksaypgqitsnmfcagyleggkkscqgdsggpvvcsgklq
givswgsgcnkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d4niyc_:

Click to download the PDB-style file with coordinates for d4niyc_.
(The format of our PDB-style files is described here.)

Timeline for d4niyc_: