Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187001] (23 PDB entries) |
Domain d4niyc_: 4niy C: [237853] Other proteins in same PDB: d4niye_, d4niyf_, d4niyg_, d4niyh_ automated match to d4niwa_ complexed with ca, zn |
PDB Entry: 4niy (more details), 2.84 Å
SCOPe Domain Sequences for d4niyc_:
Sequence, based on SEQRES records: (download)
>d4niyc_ b.47.1.2 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]} ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyesgiqvrlgedninvveg neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg wghtkssgtshpdvlkclkapilsdsscksaypgqitsnmfcagyleggkkscqgdsggp vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
>d4niyc_ b.47.1.2 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]} ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyesgiqvrlgedninvveg neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg wghtdvlkclkapilsdsscksaypgqitsnmfcagyleggkkscqgdsggpvvcsgklq givswgsgcnkpgvytkvcnyvswikqtiasn
Timeline for d4niyc_: