SCOPe 2.03: Domain d4niva_: 4niv A:

Lineage for d4niva_ (4niv A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187001] (12 PDB entries)

8. Domain d4niva_: 4niv A: [237849]
   automated match to d4niwa_
   complexed with ca, gol

Details for d4niva_

PDB Entry: 4niv, 1 Å

PDB Description: Crystal structure of trypsiligase (K60E/N143H/Y151H/D189K trypsin) trigonal form

PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d4niva_:

Sequence, based on SEQRES records:

>d4niva_ b.47.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyesgiqvrlgedninvvegneqf
isasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisgwght
kssgtshpdvlkclkapilsdsscksaypgqitsnmfcagyleggkkscqgdsggpvvcs
gklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Sequence, based on observed residues (ATOM records):

>d4niva_ b.47.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyesgiqvrlgedninvvegneqf
isasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisgwpdv
lkclkapilsdsscksaypgqitsnmfcagydsggpvvcsgklqgivswgskpgvytkvc
nyvswikqtiasn

Timeline for d4niva_:

• d4niva_ is new in SCOPe 2.03-stable
  
• d4niva_ appears in SCOPe 2.04
  
• d4niva_ appears in the current release, SCOPe 2.08