Lineage for d4niva_ (4niv A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2057491Protein automated matches [190044] (14 species)
    not a true protein
  7. 2057503Species Cow (Bos taurus) [TaxId:9913] [187001] (14 PDB entries)
  8. 2057504Domain d4niva_: 4niv A: [237849]
    automated match to d4niwa_
    complexed with ca, gol

Details for d4niva_

PDB Entry: 4niv (more details), 1 Å

PDB Description: Crystal structure of trypsiligase (K60E/N143H/Y151H/D189K trypsin) trigonal form
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d4niva_:

Sequence, based on SEQRES records: (download)

>d4niva_ b.47.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyesgiqvrlgedninvvegneqf
isasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisgwght
kssgtshpdvlkclkapilsdsscksaypgqitsnmfcagyleggkkscqgdsggpvvcs
gklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Sequence, based on observed residues (ATOM records): (download)

>d4niva_ b.47.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyesgiqvrlgedninvvegneqf
isasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisgwpdv
lkclkapilsdsscksaypgqitsnmfcagydsggpvvcsgklqgivswgskpgvytkvc
nyvswikqtiasn

SCOPe Domain Coordinates for d4niva_:

Click to download the PDB-style file with coordinates for d4niva_.
(The format of our PDB-style files is described here.)

Timeline for d4niva_: