![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology with the crossing loops |
![]() | Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) ![]() automatically mapped to Pfam PF03974 |
![]() | Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins) |
![]() | Protein automated matches [191287] (2 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [237072] (1 PDB entry) |
![]() | Domain d4niyg_: 4niy G: [237844] Other proteins in same PDB: d4niya_, d4niyb_, d4niyc_, d4niyd_ automated match to d4niye_ complexed with ca, zn |
PDB Entry: 4niy (more details), 2.84 Å
SCOPe Domain Sequences for d4niyg_:
Sequence, based on SEQRES records: (download)
>d4niyg_ b.16.1.1 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]} lekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktleg wgydyyvfdkvsspvstyrhcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvk yrvwkaeekidnavvr
>d4niyg_ b.16.1.1 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]} lekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktleg wgydyyvfdkvsspvstyrhcpdkkekkfvtaylgdagmlrynsklpivvytpdnvdvky rvwkaeekidnavvr
Timeline for d4niyg_: