Lineage for d4nd6a_ (4nd6 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105607Protein automated matches [190581] (9 species)
    not a true protein
  7. 2105626Species Methanocaldococcus jannaschii [TaxId:243232] [193079] (10 PDB entries)
  8. 2105631Domain d4nd6a_: 4nd6 A: [237842]
    automated match to d1j1ua_
    complexed with gol

Details for d4nd6a_

PDB Entry: 4nd6 (more details), 2 Å

PDB Description: Crystal structure of apo 3-nitro-tyrosine tRNA synthetase (5B) in the open form
PDB Compounds: (A:) Tyrosine-tRNA ligase

SCOPe Domain Sequences for d4nd6a_:

Sequence, based on SEQRES records: (download)

>d4nd6a_ c.26.1.1 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mdefemikrntseiiseeelrevlkkdeksahigfepsgkihlghylqikkmidlqnagf
diiilladlcaylnnkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr
lalkttlkrarrsmeliaredenpkvaeviypimqvnsahyrgvdvavggmeqrkihmla
rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
pirkrl

Sequence, based on observed residues (ATOM records): (download)

>d4nd6a_ c.26.1.1 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mdefemikrntseiiseeelrevlkkdeksahigfepsgkihlghylqikkmidlqnagf
diiilladlcaylnnkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr
lalkttlkrarrsmeliaenpkvaeviypimqvnsahyrgvdvavggmeqrkihmlarel
lpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpime
iakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilepir
krl

SCOPe Domain Coordinates for d4nd6a_:

Click to download the PDB-style file with coordinates for d4nd6a_.
(The format of our PDB-style files is described here.)

Timeline for d4nd6a_: