SCOPe 2.03: Domain d4kdla2: 4kdl A:107-196

Lineage for d4kdla2 (4kdl A:107-196)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.31.1: Cdc48 domain 2-like [54585] (1 family)

5. Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)

6. Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species)

7. Species Homo sapiens [TaxId:9606] [233318] (4 PDB entries)

8. Domain d4kdla2: 4kdl A:107-196 [237832]
   Other proteins in same PDB: d4kdla1
   automated match to d1e32a3

Details for d4kdla2

PDB Entry: 4kdl, 1.81 Å

PDB Description: Crystal structure of p97/VCP N in complex with OTU1 UBXL

PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d4kdla2:

Sequence; same for both SEQRES and ATOM records:

>d4kdla2 d.31.1.1 (A:107-196) Membrane fusion atpase p97 domain 2, P97-Nc {Homo sapiens [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikredeee

Timeline for d4kdla2:

• d4kdla2 is new in SCOPe 2.03-stable
  
• d4kdla2 appears in SCOPe 2.04
  
• d4kdla2 appears in the current release, SCOPe 2.08