Class b: All beta proteins [48724] (176 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins) |
Protein Membrane fusion ATPase p97 N-terminal domain , P97-Nn [63796] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [233316] (6 PDB entries) |
Domain d4kdla1: 4kdl A:23-106 [237831] Other proteins in same PDB: d4kdla2 automated match to d1e32a1 |
PDB Entry: 4kdl (more details), 1.81 Å
SCOPe Domain Sequences for d4kdla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kdla1 b.52.2.3 (A:23-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Human (Homo sapiens) [TaxId: 9606]} pnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdeki rmnrvvrnnlrvrlgdvisiqpcp
Timeline for d4kdla1: