Lineage for d4kdla1 (4kdl A:23-106)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1323003Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 1323057Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 1323202Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins)
  6. 1323203Protein Membrane fusion ATPase p97 N-terminal domain , P97-Nn [63796] (2 species)
  7. 1323204Species Homo sapiens [TaxId:9606] [233316] (4 PDB entries)
  8. 1323205Domain d4kdla1: 4kdl A:23-106 [237831]
    Other proteins in same PDB: d4kdla2
    automated match to d1e32a1

Details for d4kdla1

PDB Entry: 4kdl (more details), 1.81 Å

PDB Description: Crystal structure of p97/VCP N in complex with OTU1 UBXL
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d4kdla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kdla1 b.52.2.3 (A:23-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Homo sapiens [TaxId: 9606]}
pnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdeki
rmnrvvrnnlrvrlgdvisiqpcp

SCOPe Domain Coordinates for d4kdla1:

Click to download the PDB-style file with coordinates for d4kdla1.
(The format of our PDB-style files is described here.)

Timeline for d4kdla1: