Lineage for d4ka6b1 (4ka6 B:35-443)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002950Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 protein domains)
    duplication: tandem repeat of two CCP-like domains
  6. 2003049Protein automated matches [227103] (4 species)
    not a true protein
  7. 2003050Species Burkholderia pseudomallei [TaxId:272560] [237825] (3 PDB entries)
  8. 2003057Domain d4ka6b1: 4ka6 B:35-443 [237829]
    automated match to d3n3pb1
    complexed with cl, hem, mpd, na, niz

Details for d4ka6b1

PDB Entry: 4ka6 (more details), 1.7 Å

PDB Description: structure of d141a variant of b. pseudomallei katg complexed with inh
PDB Compounds: (B:) Catalase-peroxidase

SCOPe Domain Sequences for d4ka6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ka6b1 a.93.1.3 (B:35-443) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpananldkarrllwp
ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaev

SCOPe Domain Coordinates for d4ka6b1:

Click to download the PDB-style file with coordinates for d4ka6b1.
(The format of our PDB-style files is described here.)

Timeline for d4ka6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ka6b2