SCOPe 2.07: Domain d4jala1: 4jal A:2-155

Lineage for d4jala1 (4jal A:2-155)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.0: automated matches [191557] (1 protein)
   not a true family

6. Protein automated matches [190961] (22 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [234948] (2 PDB entries)

8. Domain d4jala1: 4jal A:2-155 [237816]
   Other proteins in same PDB: d4jala2, d4jalb2
   automated match to d4jaka_
   complexed with edo, epe, sah

Details for d4jala1

PDB Entry: 4jal, 2 Å

PDB Description: Crystal structure of tRNA (Um34/Cm34) methyltransferase TrmL from Escherichia coli with SAH

PDB Compounds: (A:) tRNA (cytidine(34)-2'-O)-methyltransferase

SCOPe Domain Sequences for d4jala1:

Sequence; same for both SEQRES and ATOM records:

>d4jala1 c.116.1.0 (A:2-155) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lnivlyepeippntgniirlcantgfrlhiiepmgfawddkrlrragldyheftavtrhh
dyrafleaenpqrlfalttkgtpahsavsyqdgdylmfgpetrglpasildalpaeqkir
ipmvpdsrsmnlsnavsvvvyeawrqlgypgavl

Timeline for d4jala1:

• d4jala1 first appeared in SCOPe 2.03, called d4jala_
  
• d4jala1 appears in SCOPe 2.06
  
• d4jala1 appears in the current release, SCOPe 2.08