Lineage for d4jala1 (4jal A:2-155)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528466Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2528467Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2528674Family c.116.1.0: automated matches [191557] (1 protein)
    not a true family
  6. 2528675Protein automated matches [190961] (22 species)
    not a true protein
  7. 2528714Species Escherichia coli K-12 [TaxId:83333] [234948] (2 PDB entries)
  8. 2528717Domain d4jala1: 4jal A:2-155 [237816]
    Other proteins in same PDB: d4jala2, d4jalb2
    automated match to d4jaka_
    complexed with edo, epe, sah

Details for d4jala1

PDB Entry: 4jal (more details), 2 Å

PDB Description: Crystal structure of tRNA (Um34/Cm34) methyltransferase TrmL from Escherichia coli with SAH
PDB Compounds: (A:) tRNA (cytidine(34)-2'-O)-methyltransferase

SCOPe Domain Sequences for d4jala1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jala1 c.116.1.0 (A:2-155) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lnivlyepeippntgniirlcantgfrlhiiepmgfawddkrlrragldyheftavtrhh
dyrafleaenpqrlfalttkgtpahsavsyqdgdylmfgpetrglpasildalpaeqkir
ipmvpdsrsmnlsnavsvvvyeawrqlgypgavl

SCOPe Domain Coordinates for d4jala1:

Click to download the PDB-style file with coordinates for d4jala1.
(The format of our PDB-style files is described here.)

Timeline for d4jala1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jala2