Lineage for d4j0eb2 (4j0e B:199-296)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006475Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2006476Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2006685Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2006686Protein automated matches [226851] (35 species)
    not a true protein
  7. 2006905Species Nematode (Caenorhabditis elegans) [TaxId:6239] [237814] (2 PDB entries)
  8. 2006907Domain d4j0eb2: 4j0e B:199-296 [237815]
    Other proteins in same PDB: d4j0ea1, d4j0eb1
    automated match to d1f17a1

Details for d4j0eb2

PDB Entry: 4j0e (more details), 1.6 Å

PDB Description: Crystal structure of 3-hydroxyacyl-CoA dehydrogenase from Caenorhadbitis elegans in P1 space group
PDB Compounds: (B:) Probable 3-hydroxyacyl-CoA dehydrogenase F54C8.1

SCOPe Domain Sequences for d4j0eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j0eb2 a.100.1.0 (B:199-296) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gfivnrllipyffeaarmyergdasmtdideamklgaghpmgpfeladyigldtvkfvmd
gwaakypevqlfeasplvdklvaegklgrktgdgfysy

SCOPe Domain Coordinates for d4j0eb2:

Click to download the PDB-style file with coordinates for d4j0eb2.
(The format of our PDB-style files is described here.)

Timeline for d4j0eb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4j0eb1