Lineage for d4hofa_ (4hof A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903757Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2903909Species Yeast (Candida albicans) [TaxId:5476] [53609] (17 PDB entries)
  8. 2903924Domain d4hofa_: 4hof A: [237808]
    automated match to d1aoea_
    complexed with 18h, gly, gol, ndp

Details for d4hofa_

PDB Entry: 4hof (more details), 1.76 Å

PDB Description: candida albicans dihydrofolate reductase complexed with nadph and 5- [3-(2-methoxy-4-phenylphenyl)but-1-yn-1-yl]-6-methylpyrimidine-2,4- diamine (ucp111h)
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4hofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hofa_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk

SCOPe Domain Coordinates for d4hofa_:

Click to download the PDB-style file with coordinates for d4hofa_.
(The format of our PDB-style files is described here.)

Timeline for d4hofa_: