SCOPe 2.07: Domain d4hofa_: 4hof A:

Lineage for d4hofa_ (4hof A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 protein domains)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [53609] (17 PDB entries)

8. Domain d4hofa_: 4hof A: [237808]
   automated match to d1aoea_
   complexed with 18h, gly, gol, ndp

Details for d4hofa_

PDB Entry: 4hof, 1.76 Å

PDB Description: candida albicans dihydrofolate reductase complexed with nadph and 5- [3-(2-methoxy-4-phenylphenyl)but-1-yn-1-yl]-6-methylpyrimidine-2,4- diamine (ucp111h)

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4hofa_:

Sequence; same for both SEQRES and ATOM records:

>d4hofa_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk

Timeline for d4hofa_:

• d4hofa_ first appeared in SCOPe 2.03
  
• d4hofa_ appears in SCOPe 2.06