SCOPe 2.07: Domain d4hogb1: 4hog B:3-217

Lineage for d4hogb1 (4hog B:3-217)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Candida glabrata [TaxId:284593] [237803] (4 PDB entries)

8. Domain d4hogb1: 4hog B:3-217 [237806]
   Other proteins in same PDB: d4hoga2, d4hogb2
   automated match to d3csea_
   complexed with 18h, cl, ndp

Details for d4hogb1

PDB Entry: 4hog, 2 Å

PDB Description: Candida glabrata dihydrofolate reductase complexed with NADPH and 5-[3-(2-methoxy-4-phenylphenyl)but-1-yn-1-yl]-6-methylpyrimidine-2,4-diamine (UCP111H)

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d4hogb1:

Sequence; same for both SEQRES and ATOM records:

>d4hogb1 c.71.1.1 (B:3-217) Dihydrofolate reductases, eukaryotic type {Candida glabrata [TaxId: 284593]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkk

Timeline for d4hogb1:

• d4hogb1 first appeared in SCOPe 2.03, called d4hogb_
  
• d4hogb1 appears in SCOPe 2.06
  
• d4hogb1 appears in the current release, SCOPe 2.08