Lineage for d4hoga_ (4hog A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1384489Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1384490Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1384491Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1384658Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 1384659Species Candida glabrata [TaxId:284593] [237803] (1 PDB entry)
  8. 1384660Domain d4hoga_: 4hog A: [237804]
    automated match to d3csea_
    complexed with 18h, cl, ndp

Details for d4hoga_

PDB Entry: 4hog (more details), 2 Å

PDB Description: Candida glabrata dihydrofolate reductase complexed with NADPH and 5-[3-(2-methoxy-4-phenylphenyl)but-1-yn-1-yl]-6-methylpyrimidine-2,4-diamine (UCP111H)
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4hoga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hoga_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Candida glabrata [TaxId: 284593]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkklehhhhhhhh

SCOPe Domain Coordinates for d4hoga_:

Click to download the PDB-style file with coordinates for d4hoga_.
(The format of our PDB-style files is described here.)

Timeline for d4hoga_: