SCOPe 2.06: Domain d1bvp62: 1bvp 6:121-254

Lineage for d1bvp62 (1bvp 6:121-254)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.19: Viral protein domain [49817] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
Superfamily b.19.1: Viral protein domain [49818] (4 families)
forms homotrimers
Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins)
this domain is inserted into a multihelical domain
Protein BTV vp7, central (top) domain [49820] (1 species)
Species Bluetongue virus [TaxId:40051] [49821] (2 PDB entries)
Domain d1bvp62: 1bvp 6:121-254 [23780]
Other proteins in same PDB: d1bvp11, d1bvp21, d1bvp31, d1bvp41, d1bvp51, d1bvp61

Details for d1bvp62

PDB Entry: 1bvp (more details), 2.6 Å

PDB Description: the crystal structure of bluetongue virus vp7

PDB Compounds: (6:) bluetongue virus coat protein vp7

SCOPe Domain Sequences for d1bvp62:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvp62 b.19.1.1 (6:121-254) BTV vp7, central (top) domain {Bluetongue virus [TaxId: 40051]}
parqpygffleteetfqpgrwfmraaqavtavvcgpdmiqvslnagargdvqqifqgrnd
pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvhnptqqn
amvqiqvvfyismd

SCOPe Domain Coordinates for d1bvp62:

Click to download the PDB-style file with coordinates for d1bvp62.
(The format of our PDB-style files is described here.)

Timeline for d1bvp62: