Lineage for d4cp3b_ (4cp3 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903244Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1903245Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1903467Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 1903468Protein automated matches [190710] (3 species)
    not a true protein
  7. 1903469Species Human (Homo sapiens) [TaxId:9606] [187857] (25 PDB entries)
  8. 1903505Domain d4cp3b_: 4cp3 B: [237788]
    automated match to d1buoa_
    complexed with rbt

Details for d4cp3b_

PDB Entry: 4cp3 (more details), 2.3 Å

PDB Description: the structure of bcl6 btb (poz) domain in complex with the ansamycin antibiotic rifabutin.
PDB Compounds: (B:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d4cp3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cp3b_ d.42.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
as

SCOPe Domain Coordinates for d4cp3b_:

Click to download the PDB-style file with coordinates for d4cp3b_.
(The format of our PDB-style files is described here.)

Timeline for d4cp3b_: