SCOPe 2.08: Domain d4cp3b1: 4cp3 B:9-128

Lineage for d4cp3b1 (4cp3 B:9-128)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)

8. Domain d4cp3b1: 4cp3 B:9-128 [237788]
   Other proteins in same PDB: d4cp3a2, d4cp3b2
   automated match to d1buoa_
   complexed with rbt

Details for d4cp3b1

PDB Entry: 4cp3, 2.3 Å

PDB Description: the structure of bcl6 btb (poz) domain in complex with the ansamycin antibiotic rifabutin.

PDB Compounds: (B:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d4cp3b1:

Sequence; same for both SEQRES and ATOM records:

>d4cp3b1 d.42.1.0 (B:9-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlkrn
lsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfikas

Timeline for d4cp3b1:

• d4cp3b1 first appeared in SCOPe 2.03, called d4cp3b_
  
• d4cp3b1 appears in SCOPe 2.07