| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
| Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
| Protein automated matches [190710] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187857] (18 PDB entries) |
| Domain d4cp3a_: 4cp3 A: [237787] automated match to d1buoa_ complexed with rbt |
PDB Entry: 4cp3 (more details), 2.3 Å
SCOPe Domain Sequences for d4cp3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cp3a_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdql
krnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfi
ka
Timeline for d4cp3a_: