Lineage for d4cp3a1 (4cp3 A:9-127)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945784Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2945785Protein automated matches [190710] (5 species)
    not a true protein
  7. 2945786Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)
  8. 2945830Domain d4cp3a1: 4cp3 A:9-127 [237787]
    Other proteins in same PDB: d4cp3a2, d4cp3b2
    automated match to d1buoa_
    complexed with rbt

Details for d4cp3a1

PDB Entry: 4cp3 (more details), 2.3 Å

PDB Description: the structure of bcl6 btb (poz) domain in complex with the ansamycin antibiotic rifabutin.
PDB Compounds: (A:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d4cp3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cp3a1 d.42.1.0 (A:9-127) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlkrn
lsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfika

SCOPe Domain Coordinates for d4cp3a1:

Click to download the PDB-style file with coordinates for d4cp3a1.
(The format of our PDB-style files is described here.)

Timeline for d4cp3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cp3a2