Lineage for d4cdcg_ (4cdc G:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2063610Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2064215Superfamily b.61.5: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75001] (2 families) (S)
    automatically mapped to Pfam PF08773
  5. 2064216Family b.61.5.1: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75002] (1 protein)
  6. 2064217Protein Dipeptidyl peptidase I (cathepsin C), exclusion domain [75003] (2 species)
  7. 2064218Species Human (Homo sapiens) [TaxId:9606] [75004] (7 PDB entries)
  8. 2064228Domain d4cdcg_: 4cdc G: [237786]
    automated match to d1k3ba_
    complexed with 6ao, cl, gol, nag

Details for d4cdcg_

PDB Entry: 4cdc (more details), 2.4 Å

PDB Description: Human DPP1 in complex with (2S)-2-amino-N-((1S)-1-cyano-2-(4- phenylphenyl)ethyl)butanamide
PDB Compounds: (G:) dipeptidyl peptidase 1 exclusion domain chain

SCOPe Domain Sequences for d4cdcg_:

Sequence, based on SEQRES records: (download)

>d4cdcg_ b.61.5.1 (G:) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Human (Homo sapiens) [TaxId: 9606]}
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkvg

Sequence, based on observed residues (ATOM records): (download)

>d4cdcg_ b.61.5.1 (G:) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Human (Homo sapiens) [TaxId: 9606]}
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykvttycnetmtgwvhdvlgrnwacftgkkvg

SCOPe Domain Coordinates for d4cdcg_:

Click to download the PDB-style file with coordinates for d4cdcg_.
(The format of our PDB-style files is described here.)

Timeline for d4cdcg_: