SCOPe 2.05: Domain d4cdcd_: 4cdc D:

Lineage for d4cdcd_ (4cdc D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.5: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75001] (2 families)
   automatically mapped to Pfam PF08773

5. Family b.61.5.1: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75002] (1 protein)

6. Protein Dipeptidyl peptidase I (cathepsin C), exclusion domain [75003] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75004] (7 PDB entries)

8. Domain d4cdcd_: 4cdc D: [237783]
   automated match to d1k3ba_
   complexed with 6ao, cl, gol, nag

Details for d4cdcd_

PDB Entry: 4cdc, 2.4 Å

PDB Description: human dpp1 in complex with (2s)-2-amino-n-((1s)-1-cyano-2-(4- phenylphenyl)ethyl)butanamide

PDB Compounds: (D:) dipeptidyl peptidase 1 exclusion domain chain

SCOPe Domain Sequences for d4cdcd_:

Sequence, based on SEQRES records:

>d4cdcd_ b.61.5.1 (D:) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Human (Homo sapiens) [TaxId: 9606]}
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkv

Sequence, based on observed residues (ATOM records):

>d4cdcd_ b.61.5.1 (D:) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Human (Homo sapiens) [TaxId: 9606]}
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykkvttycnetmtgwvhdvlgrnwacftgkkv

Timeline for d4cdcd_:

• d4cdcd_ first appeared in SCOPe 2.03
  
• d4cdcd_ appears in SCOPe 2.04
  
• d4cdcd_ appears in SCOPe 2.06
  
• d4cdcd_ appears in the current release, SCOPe 2.08