Lineage for d4cdea_ (4cde A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2073248Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2073895Superfamily b.61.5: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75001] (2 families) (S)
    automatically mapped to Pfam PF08773
  5. 2073896Family b.61.5.1: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75002] (1 protein)
  6. 2073897Protein Dipeptidyl peptidase I (cathepsin C), exclusion domain [75003] (2 species)
  7. 2073898Species Human (Homo sapiens) [TaxId:9606] [75004] (7 PDB entries)
  8. 2073910Domain d4cdea_: 4cde A: [237781]
    automated match to d1k3ba_
    complexed with cl, nag, u6b

Details for d4cdea_

PDB Entry: 4cde (more details), 2.4 Å

PDB Description: human dpp1 in complex with 4-amino-n-((1s)-1-cyano-2-(4-(4- cyanophenyl)phenyl)ethyl)tetrahydropyran-4-carboxamide
PDB Compounds: (A:) dipeptidyl peptidase 1 exclusion domain chain

SCOPe Domain Sequences for d4cdea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cdea_ b.61.5.1 (A:) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Human (Homo sapiens) [TaxId: 9606]}
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkv

SCOPe Domain Coordinates for d4cdea_:

Click to download the PDB-style file with coordinates for d4cdea_.
(The format of our PDB-style files is described here.)

Timeline for d4cdea_: