Lineage for d4c5nc_ (4c5n C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (40 species)
    not a true protein
  7. 2137888Species Staphylococcus aureus [TaxId:1280] [187913] (4 PDB entries)
  8. 2137891Domain d4c5nc_: 4c5n C: [237778]
    automated match to d1jxha_
    complexed with acp, pxl, so4, ueg

Details for d4c5nc_

PDB Entry: 4c5n (more details), 1.75 Å

PDB Description: Structure of the pyridoxal kinase from Staphylococcus aureus in complex with AMP-PCP and pyridoxal
PDB Compounds: (C:) phosphomethylpyrimidine kinase

SCOPe Domain Sequences for d4c5nc_:

Sequence, based on SEQRES records: (download)

>d4c5nc_ c.72.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
alkkvltiagsdtsagagmqadlktfqeldtygmvaltaivtmdkdtwshdvtplpmdvf
ekqletalsigpdaiktgmlgteeiikragevyeasnaqyfvvdpvmvckgedevlnpgn
teamikyllpkatvvtpnlfeagqlsglgklnsiedmkkaatiifdkgaqhviikggkal
dqdksydlyydgqtfyqlttdmfqqsynhgagctfaaattaylangkspkeavisakafv
asaikngwkmndfvgpvdhgaynriehidvevtev

Sequence, based on observed residues (ATOM records): (download)

>d4c5nc_ c.72.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
alkkvltiagsdtsagagmqadlktfqeldtygmvaltaivtmdkdtwshdvtplpmdvf
ekqletalsigpdaiktgmlgteeiikragevyeasnaqyfvvdpvmnpgnteamikyll
pkatvvtpnlfeagqlsglgklnsiedmkkaatiifdkgaqhviikggkaldqdksydly
ydgqtfyqlttdmfqqsynhgagctfaaattaylangkspkeavisakafvasaikngwk
mndfvgpvdhgaynriehidvevtev

SCOPe Domain Coordinates for d4c5nc_:

Click to download the PDB-style file with coordinates for d4c5nc_.
(The format of our PDB-style files is described here.)

Timeline for d4c5nc_: