Lineage for d4c5nd_ (4c5n D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2478216Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2478217Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2478486Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2478487Protein automated matches [190117] (42 species)
    not a true protein
  7. 2478672Species Staphylococcus aureus [TaxId:1280] [187913] (4 PDB entries)
  8. 2478676Domain d4c5nd_: 4c5n D: [237777]
    automated match to d1jxha_
    complexed with acp, pxl, so4, ueg

Details for d4c5nd_

PDB Entry: 4c5n (more details), 1.75 Å

PDB Description: Structure of the pyridoxal kinase from Staphylococcus aureus in complex with AMP-PCP and pyridoxal
PDB Compounds: (D:) phosphomethylpyrimidine kinase

SCOPe Domain Sequences for d4c5nd_:

Sequence, based on SEQRES records: (download)

>d4c5nd_ c.72.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]}
galkkvltiagsdtsagagmqadlktfqeldtygmvaltaivtmdkdtwshdvtplpmdv
fekqletalsigpdaiktgmlgteeiikragevyeasnaqyfvvdpvmvckgedevlnpg
nteamikyllpkatvvtpnlfeagqlsglgklnsiedmkkaatiifdkgaqhviikggka
ldqdksydlyydgqtfyqlttdmfqqsynhgagctfaaattaylangkspkeavisakaf
vasaikngwkmndfvgpvdhgaynriehidvevtev

Sequence, based on observed residues (ATOM records): (download)

>d4c5nd_ c.72.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]}
galkkvltiagsdtsagagmqadlktfqeldtygmvaltaivtmdkdtwshdvtplpmdv
fekqletalsigpdaiktgmlgteeiikragevyeasnaqyfvvdpvmvcnpgnteamik
yllpkatvvtpnlfeagqlsglgklnsiedmkkaatiifdkgaqhviikggkaldqdksy
dlyydgqtfyqlttdmfqqsynhgagctfaaattaylangkspkeavisakafvasaikn
gwkmndfvgpvdhgaynriehidvevtev

SCOPe Domain Coordinates for d4c5nd_:

Click to download the PDB-style file with coordinates for d4c5nd_.
(The format of our PDB-style files is described here.)

Timeline for d4c5nd_: