SCOPe 2.08: Domain d4c5jb1: 4c5j B:2-276

Lineage for d4c5jb1 (4c5j B:2-276)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (50 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [237768] (4 PDB entries)

8. Domain d4c5jb1: 4c5j B:2-276 [237773]
   Other proteins in same PDB: d4c5ja2, d4c5jb2, d4c5jc2, d4c5jd2
   automated match to d1jxha_
   complexed with so4

Details for d4c5jb1

PDB Entry: 4c5j, 1.45 Å

PDB Description: Structure of the pyridoxal kinase from Staphylococcus aureus

PDB Compounds: (B:) phosphomethylpyrimidine kinase

SCOPe Domain Sequences for d4c5jb1:

Sequence; same for both SEQRES and ATOM records:

>d4c5jb1 c.72.1.0 (B:2-276) automated matches {Staphylococcus aureus [TaxId: 158878]}
alkkvltiagsdtsagagmqadlktfqeldtygmvaltaivtmdkdtwshdvtplpmdvf
ekqletalsigpdaiktgmlgteeiikragevyeasnaqyfvvdpvmvckgedevlnpgn
teamikyllpkatvvtpnlfeagqlsglgklnsiedmkkaatiifdkgaqhviikggkal
dqdksydlyydgqtfyqlttdmfqqsynhgagctfaaattaylangkspkeavisakafv
asaikngwkmndfvgpvdhgaynriehidvevtev

Timeline for d4c5jb1:

• d4c5jb1 first appeared in SCOPe 2.03, called d4c5jb_
  
• d4c5jb1 appears in SCOPe 2.07