![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
![]() | Protein automated matches [190117] (50 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:158878] [237768] (4 PDB entries) |
![]() | Domain d4c5jb1: 4c5j B:2-276 [237773] Other proteins in same PDB: d4c5ja2, d4c5jb2, d4c5jc2, d4c5jd2 automated match to d1jxha_ complexed with so4 |
PDB Entry: 4c5j (more details), 1.45 Å
SCOPe Domain Sequences for d4c5jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c5jb1 c.72.1.0 (B:2-276) automated matches {Staphylococcus aureus [TaxId: 158878]} alkkvltiagsdtsagagmqadlktfqeldtygmvaltaivtmdkdtwshdvtplpmdvf ekqletalsigpdaiktgmlgteeiikragevyeasnaqyfvvdpvmvckgedevlnpgn teamikyllpkatvvtpnlfeagqlsglgklnsiedmkkaatiifdkgaqhviikggkal dqdksydlyydgqtfyqlttdmfqqsynhgagctfaaattaylangkspkeavisakafv asaikngwkmndfvgpvdhgaynriehidvevtev
Timeline for d4c5jb1: